HPA019127

SMARCB1 antibody from MilliporeSigma / Merck KGaA
BAF47, hSNFS, Ini1, PPP1R144, RDT, Sfh1p, SNF5, SNF5L1, Snr1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019127
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA019127, RRID:AB_1851165
Product name
Anti-SMARCB1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA019127
Antibody type
Polyclonal
Antigen
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EKENSPEKFALKLCSELGLGGEFVTTIAYSIRGQL
SWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLE
TLTDAEMEKKIRDQDRNTRRMRRLANTA
Storage
-20C
Provider Type Product Number
- No reagents -