HPA019127

SMARCB1 antibody from Atlas Antibodies
BAF47, hSNFS, Ini1, PPP1R144, RDT, Sfh1p, SNF5, SNF5L1, Snr1
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA019127
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019127, RRID:AB_1851165
Product name
Anti-SMARCB1
Provider product page
Atlas Antibodies - HPA019127
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EKENSPEKFALKLCSELGLGGEFVTTIAYSIRGQL
SWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLE
TLTDAEMEKKIRDQDRNTRRMRRLANTA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -