Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310665 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Indian Hedgehog (IHH) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-IHH antibody: synthetic peptide directed towards the N terminal of human IHH
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
AAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPE
KTLGA SGRYEGKIAR- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references 3β-Hydroxysterol-Delta24 reductase plays an important role in long bone growth by protecting chondrocytes from reactive oxygen species.
Indian hedgehog gene transfer augments hematopoietic support of human stromal cells including NOD/SCID-beta2m-/- repopulating cells.
Mirza R, Qiao S, Tateyama K, Miyamoto T, Xiuli L, Seo H
Journal of bone and mineral metabolism 2012 Mar;30(2):144-53
Journal of bone and mineral metabolism 2012 Mar;30(2):144-53
Indian hedgehog gene transfer augments hematopoietic support of human stromal cells including NOD/SCID-beta2m-/- repopulating cells.
Kobune M, Ito Y, Kawano Y, Sasaki K, Uchida H, Nakamura K, Dehari H, Chiba H, Takimoto R, Matsunaga T, Terui T, Kato J, Niitsu Y, Hamada H
Blood 2004 Aug 15;104(4):1002-9
Blood 2004 Aug 15;104(4):1002-9
No comments: Submit comment
No validations: Submit validation data