Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503226 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Neurotrophic tyrosine Kinase, Receptor, Type 3 (NTRK3) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NTRK3 antibody: synthetic peptide directed towards the C terminal of human NTRK3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
ERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKIL
HALGK ATPIYLDILG- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Linkage disequilibrium mapping of a chromosome 15q25-26 major depression linkage region and sequencing of NTRK3.
Verma R, Holmans P, Knowles JA, Grover D, Evgrafov OV, Crowe RR, Scheftner WA, Weissman MM, DePaulo JR Jr, Potash JB, Levinson DF
Biological psychiatry 2008 Jun 15;63(12):1185-9
Biological psychiatry 2008 Jun 15;63(12):1185-9
No comments: Submit comment
No validations: Submit validation data