HPA035222

antibody from Atlas Antibodies

Targeting: IKZF1 hIk-1, Hs.54452, IKAROS, LyF-1, PPP1R92, ZNFN1A1

Antibody data

Submit

Validation data

Product number: HPA035222 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA035222, RRID:AB_2674525
Product name: Anti-IKZF1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: DADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPED LSTTSGGQQSSKSDRVVASNVKVETQSDEENGRAC EMNGEECAEDLRMLDASGEKMNGSH
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

IKZF1 protein structure - HPA035222 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human tonsil and cerebral cortex tissues using Anti-IKZF1 antibody. Corresponding IKZF1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, kidney, testis and tonsil using Anti-IKZF1 antibody HPA035222 (A) shows similar protein distribution across tissues to independent antibody HPA035221 (B).
Antibody #2 product nr: HPA035221
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human spleen shows moderate nuclear positivity in cells in red pulp and white pulp.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-IKZF1 antibody HPA035222.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-IKZF1 antibody HPA035222.
Sample type: HUMAN