HPA022914

DVL2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022914
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022914, RRID:AB_1847683
Product name
Anti-DVL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022914
Antibody type
Polyclonal
Antigen
Segment polarity protein dishevelled homolog DVL-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FNGRVVSWLVSSDNPQPEMAPPVHEPRAELAPPAP
PLPPLPPERTSGIGDSRPPSFHPNVSSSHENLEPE
TETESVV
Storage
-20C
Provider Type Product Number
- No reagents -