HPA010928

SFTPC antibody from Atlas Antibodies
BRICD6, PSP-C, SFTP2, SMDP2, SP-C
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010928
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010928, RRID:AB_1857425
Product name
Anti-SFTPC
Provider product page
Atlas Antibodies - HPA010928
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PEAQQRLALSEHLVTTATFSIGSTGLVVYDYQQLL
IAYKPAPGTCCYIMKIAPESIPSLEALTRKVHNFQ
AKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVS
TLCG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -