HPA010928

SFTPC antibody from Sigma-Aldrich
BRICD6, PSP-C, SFTP2, SMDP2, SP-C
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010928
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010928, RRID:AB_1857425
Product name
Anti-SFTPC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010928
Antibody type
Polyclonal
Antigen
Pulmonary surfactant-associated protein C Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PEAQQRLALSEHLVTTATFSIGSTGLVVYDYQQLL
IAYKPAPGTCCYIMKIAPESIPSLEALTRKVHNFQ
AKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVS
TLCG
Storage
-20C
Provider Type Product Number
- No reagents -