H00002289-B01P
antibody from Abnova Corporation
Targeting: FKBP5
FKBP51, FKBP54, P54, PPIase, Ptg-10
Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002289-B01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002289-B01P, RRID:AB_10720342
- Product name
- FKBP5 purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human FKBP5 protein.
- Antigen sequence
MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLK
IVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSS
HDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHL
LCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
DLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGR
CGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQ
REEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEV
TLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFK
GGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESF
LLAAFLNLAMCYLKLREYTKAVECCDKALGLDSAN
EKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNK
AARLQISMCQKKAKEHNERDRRIYANMFKKFAEQD
AKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEG
HV- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references FKBP51 employs both scaffold and isomerase functions to promote NF-κB activation in melanoma.
FKBP51 increases the tumour-promoter potential of TGF-beta.
FK506 binding protein 51 positively regulates melanoma stemness and metastatic potential.
Romano S, Xiao Y, Nakaya M, D'Angelillo A, Chang M, Jin J, Hausch F, Masullo M, Feng X, Romano MF, Sun SC
Nucleic acids research 2015 Aug 18;43(14):6983-93
Nucleic acids research 2015 Aug 18;43(14):6983-93
FKBP51 increases the tumour-promoter potential of TGF-beta.
Romano S, D'Angelillo A, D'Arrigo P, Staibano S, Greco A, Brunetti A, Scalvenzi M, Bisogni R, Scala I, Romano MF
Clinical and translational medicine 2014 Jan 27;3(1):1
Clinical and translational medicine 2014 Jan 27;3(1):1
FK506 binding protein 51 positively regulates melanoma stemness and metastatic potential.
Romano S, Staibano S, Greco A, Brunetti A, Nappo G, Ilardi G, Martinelli R, Sorrentino A, Di Pace A, Mascolo M, Bisogni R, Scalvenzi M, Alfano B, Romano MF
Cell death & disease 2013 Apr 4;4:e578
Cell death & disease 2013 Apr 4;4:e578
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- FKBP5 MaxPab polyclonal antibody. Western Blot analysis of FKBP5 expression in human placenta.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of FKBP5 expression in transfected 293T cell line (H00002289-T01) by FKBP5 MaxPab polyclonal antibody.Lane 1: FKBP5 transfected lysate(50.27 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of purified MaxPab antibody to FKBP5 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of purified MaxPab antibody to FKBP5 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol