HPA031092

FKBP5 antibody from MilliporeSigma / Merck KGaA
FKBP51, FKBP54, P54, PPIase, Ptg-10
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031092
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA031092, RRID:AB_10600195
Product name
Anti-FKBP5 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031092
Antibody type
Polyclonal
Antigen
FK506 binding protein 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCR
DVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYL
GPRYGFGEAGKPKFGIEP
Storage
-20C
Provider Type Product Number
- No reagents -