HPA027806

NEO1 antibody from Sigma-Aldrich
HsT17534, IGDCC2, NGN, NTN1R2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027806
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027806, RRID:AB_10601006
Product name
Anti-NEO1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027806
Antibody type
Polyclonal
Antigen
neogenin homolog 1 (chicken) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SVNGSHKYKGNSKDVKPPDLWIHHERLELKPIDKS
PDPNPIMTDTPIPRNSQDITPVDNSMDSNIHQRRN
SYRGHESEDSMSTLAGR
Storage
-20C
Provider Type Product Number
- No reagents -