Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183307 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 645 (ZNF645) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF645 antibody: synthetic peptide directed towards the N terminal of human ZNF645
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
MNKMPAGEQECEYNKEGKYYSKGVKLVRKKKKIPG
YRWGD IKINIIGEKD- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Human RING finger protein ZNF645 is a novel testis-specific E3 ubiquitin ligase.
Promoter demethylation mediates the expression of ZNF645, a novel cancer/testis gene.
Liu YQ, Bai G, Zhang H, Su D, Tao DC, Yang Y, Ma YX, Zhang SZ
Asian journal of andrology 2010 Sep;12(5):658-66
Asian journal of andrology 2010 Sep;12(5):658-66
Promoter demethylation mediates the expression of ZNF645, a novel cancer/testis gene.
Bai G, Liu Y, Zhang H, Su D, Tao D, Yang Y, Ma Y, Zhang S
BMB reports 2010 Jun;43(6):400-6
BMB reports 2010 Jun;43(6):400-6
No comments: Submit comment
No validations: Submit validation data