H00029760-M04

BLNK antibody from Abnova Corporation
BASH, bca, BLNK-s, Ly57, SLP-65, SLP65

Antibody data

Product number
H00029760-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00029760-M04, RRID:AB_1571663
Product name
BLNK monoclonal antibody (M04), clone 1D7
Provider product page
Abnova Corporation - H00029760-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant BLNK.
Antigen sequence
KQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTIS
EQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFL
IRKSSGHDSKQPYTLVVFFNKRVYNIPVRF
Isotype
IgG
Antibody clone number
1D7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -