H00006607-B01

SMN2 antibody from Abnova Corporation
BCD541, GEMIN1, SMNC, TDRD16B

Antibody data

Product number
H00006607-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006607-B01, RRID:AB_1580810
Product name
SMN2 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00006607-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human SMN2 protein.
Antigen sequence
MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWD
DTALIKAYDKAVASFKHALKNGDICETSGKPKTTP
KRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSED
GCIYPATIASIDFKRETCVVVYTGYGNREEQNLSD
LLSPICEVANNIEQNAQENENESQVSTDESENSRS
PGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKP
GLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPP
PPPICPDSLDDADALGSMLISWYMSGYHTGYYMEM
LA
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -