Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006607-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006607-M01, RRID:AB_10720047
- Product name
- SMN2 monoclonal antibody (M01), clone 2B11-2A9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant SMN2.
- Antigen sequence
MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWD
DTALIKAYDKAVASFKHALKNGDICETSGKPKTTP
KRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSED
GCIYPATIASIDFKRETCVVVYTGYGNREEQNLSD
LLSPICEVANNIEQNAQENENESQVSTDESENSRS
PGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKP
GLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPP
PPPICPDSLDDADALGSMLISWYMSGYHTGYYMEM
LA- Isotype
- IgG
- Antibody clone number
- 2B11-2A9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SMN2 monoclonal antibody (M01), clone 2B11-2A9 Western Blot analysis of SMN2 expression in IMR-32 ( Cat # L008V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SMN2 monoclonal antibody (M01), clone 2B11-2A9. Western Blot analysis of SMN2 expression in human colon.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SMN2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to SMN2 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to SMN2 on formalin-fixed paraffin-embedded human heart tissue. [antibody concentration 1 ~ 10 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol