Antibody data
- Antibody Data
- Antigen structure
- References [15]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010413-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010413-M01, RRID:AB_535096
- Product name
- YAP1 monoclonal antibody (M01), clone 2F12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant YAP1.
- Antigen sequence
QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMR
LRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQH
VRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTA
QHLR- Isotype
- IgG
- Antibody clone number
- 2F12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Early preimplantation cells expressing Cdx2 exhibit plasticity of specification to TE and ICM lineages through positional changes.
Par-aPKC-dependent and -independent mechanisms cooperatively control cell polarity, Hippo signaling, and cell positioning in 16-cell stage mouse embryos.
Oncoprotein YAP regulates the spindle checkpoint activation in a mitotic phosphorylation-dependent manner through up-regulation of BubR1.
A functional interaction between Hippo-YAP signalling and FoxO1 mediates the oxidative stress response.
Stromal-epithelial crosstalk regulates kidney progenitor cell differentiation.
Serum deprivation inhibits the transcriptional co-activator YAP and cell growth via phosphorylation of the 130-kDa isoform of Angiomotin by the LATS1/2 protein kinases.
CDK1 phosphorylation of YAP promotes mitotic defects and cell motility and is essential for neoplastic transformation.
Amot130 adapts atrophin-1 interacting protein 4 to inhibit yes-associated protein signaling and cell growth.
YAP1 recruits c-Abl to protect angiomotin-like 1 from Nedd4-mediated degradation.
Tead4 is constitutively nuclear, while nuclear vs. cytoplasmic Yap distribution is regulated in preimplantation mouse embryos.
Hippo pathway regulation by cell morphology and stress fibers.
Inactivation of Merlin in malignant mesothelioma cells and the Hippo signaling cascade dysregulation.
Identification of miR-193b targets in breast cancer cells and systems biological analysis of their functional impact.
LATS2 is a tumor suppressor gene of malignant mesothelioma.
Merlin is a potent inhibitor of glioma growth.
Toyooka Y, Oka S, Fujimori T
Developmental biology 2016 Mar 1;411(1):50-60
Developmental biology 2016 Mar 1;411(1):50-60
Par-aPKC-dependent and -independent mechanisms cooperatively control cell polarity, Hippo signaling, and cell positioning in 16-cell stage mouse embryos.
Hirate Y, Hirahara S, Inoue K, Kiyonari H, Niwa H, Sasaki H
Development, growth & differentiation 2015 Oct;57(8):544-56
Development, growth & differentiation 2015 Oct;57(8):544-56
Oncoprotein YAP regulates the spindle checkpoint activation in a mitotic phosphorylation-dependent manner through up-regulation of BubR1.
Yang S, Zhang L, Chen X, Chen Y, Dong J
The Journal of biological chemistry 2015 Mar 6;290(10):6191-202
The Journal of biological chemistry 2015 Mar 6;290(10):6191-202
A functional interaction between Hippo-YAP signalling and FoxO1 mediates the oxidative stress response.
Shao D, Zhai P, Del Re DP, Sciarretta S, Yabuta N, Nojima H, Lim DS, Pan D, Sadoshima J
Nature communications 2014;5:3315
Nature communications 2014;5:3315
Stromal-epithelial crosstalk regulates kidney progenitor cell differentiation.
Das A, Tanigawa S, Karner CM, Xin M, Lum L, Chen C, Olson EN, Perantoni AO, Carroll TJ
Nature cell biology 2013 Sep;15(9):1035-44
Nature cell biology 2013 Sep;15(9):1035-44
Serum deprivation inhibits the transcriptional co-activator YAP and cell growth via phosphorylation of the 130-kDa isoform of Angiomotin by the LATS1/2 protein kinases.
Adler JJ, Johnson DE, Heller BL, Bringman LR, Ranahan WP, Conwell MD, Sun Y, Hudmon A, Wells CD
Proceedings of the National Academy of Sciences of the United States of America 2013 Oct 22;110(43):17368-73
Proceedings of the National Academy of Sciences of the United States of America 2013 Oct 22;110(43):17368-73
CDK1 phosphorylation of YAP promotes mitotic defects and cell motility and is essential for neoplastic transformation.
Yang S, Zhang L, Liu M, Chong R, Ding SJ, Chen Y, Dong J
Cancer research 2013 Nov 15;73(22):6722-33
Cancer research 2013 Nov 15;73(22):6722-33
Amot130 adapts atrophin-1 interacting protein 4 to inhibit yes-associated protein signaling and cell growth.
Adler JJ, Heller BL, Bringman LR, Ranahan WP, Cocklin RR, Goebl MG, Oh M, Lim HS, Ingham RJ, Wells CD
The Journal of biological chemistry 2013 May 24;288(21):15181-93
The Journal of biological chemistry 2013 May 24;288(21):15181-93
YAP1 recruits c-Abl to protect angiomotin-like 1 from Nedd4-mediated degradation.
Skouloudaki K, Walz G
PloS one 2012;7(4):e35735
PloS one 2012;7(4):e35735
Tead4 is constitutively nuclear, while nuclear vs. cytoplasmic Yap distribution is regulated in preimplantation mouse embryos.
Hirate Y, Cockburn K, Rossant J, Sasaki H
Proceedings of the National Academy of Sciences of the United States of America 2012 Dec 11;109(50):E3389-90; author reply E3391-2
Proceedings of the National Academy of Sciences of the United States of America 2012 Dec 11;109(50):E3389-90; author reply E3391-2
Hippo pathway regulation by cell morphology and stress fibers.
Wada K, Itoga K, Okano T, Yonemura S, Sasaki H
Development (Cambridge, England) 2011 Sep;138(18):3907-14
Development (Cambridge, England) 2011 Sep;138(18):3907-14
Inactivation of Merlin in malignant mesothelioma cells and the Hippo signaling cascade dysregulation.
Sekido Y
Pathology international 2011 Jun;61(6):331-44
Pathology international 2011 Jun;61(6):331-44
Identification of miR-193b targets in breast cancer cells and systems biological analysis of their functional impact.
Leivonen SK, Rokka A, Ostling P, Kohonen P, Corthals GL, Kallioniemi O, Perälä M
Molecular & cellular proteomics : MCP 2011 Jul;10(7):M110.005322
Molecular & cellular proteomics : MCP 2011 Jul;10(7):M110.005322
LATS2 is a tumor suppressor gene of malignant mesothelioma.
Murakami H, Mizuno T, Taniguchi T, Fujii M, Ishiguro F, Fukui T, Akatsuka S, Horio Y, Hida T, Kondo Y, Toyokuni S, Osada H, Sekido Y
Cancer research 2011 Feb 1;71(3):873-83
Cancer research 2011 Feb 1;71(3):873-83
Merlin is a potent inhibitor of glioma growth.
Lau YK, Murray LB, Houshmandi SS, Xu Y, Gutmann DH, Yu Q
Cancer research 2008 Jul 15;68(14):5733-42
Cancer research 2008 Jul 15;68(14):5733-42
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- YAP1 monoclonal antibody (M01), clone 2F12. Western Blot analysis of YAP1 expression in Hela S3 NE.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of YAP1 expression in transfected 293T cell line by YAP1 monoclonal antibody (M01), clone 2F12.Lane 1: YAP1 transfected lysate (Predicted MW: 54.5 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to YAP1 on HeLa cell. [antibody concentration 30 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to YAP1 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol