Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007220-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007220-A01, RRID:AB_462727
- Product name
- TRPC1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant TRPC1.
- Antigen sequence
AHNKFHDFADRKDWDAFHPTLVAEGLFAFANVLSY
LRLFFMYTTSSILGPLQISMGQMLQDFGK- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Functional interactions among STIM1, Orai1 and TRPC1 on the activation of SOCs in HL-7702 cells.
Measuring Ca2+ influxes of TRPC1-dependent Ca2+ channels in HL-7702 cells with non-invasive micro-test technique.
Zhang ZY, Pan LJ, Zhang ZM
Amino acids 2010 Jun;39(1):195-204
Amino acids 2010 Jun;39(1):195-204
Measuring Ca2+ influxes of TRPC1-dependent Ca2+ channels in HL-7702 cells with non-invasive micro-test technique.
Zhang ZY, Wang WJ, Pan LJ, Xu Y, Zhang ZM
World journal of gastroenterology 2009 Sep 7;15(33):4150-5
World journal of gastroenterology 2009 Sep 7;15(33):4150-5
No comments: Submit comment
No validations: Submit validation data