WH0006556M1

SLC11A1 antibody from Sigma-Aldrich
LSH, NRAMP, NRAMP1
ELISA
Recommended by provider

Antibody data

Product number
WH0006556M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0006556M1, RRID:AB_1843614
Product name
Monoclonal Anti-SLC11A1 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0006556M1
Antibody type
Monoclonal
Antigen
SLC11A1 (NP_000569, a.a. 308-351) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
QAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVA
VDIYQGGV* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -