HPA022128

DSG1 antibody from Sigma-Aldrich
CDHF4, DSG
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022128
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022128, RRID:AB_1847620
Product name
Anti-DSG1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022128
Antibody type
Polyclonal
Antigen
Desmoglein-1 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SLQLSIGVRNKAEFHHSIMSQYKLKASAISVTVLN
VIEGPVFRPGSKTYVVTGNMGSNDKVGDFVATDLD
TGRPSTTVRYVMGNNPADLLAVDSRTGKLTLKNKV
TKEQYNMLGGKYQGTILSIDDNLQRTCTGT
Storage
-20C
Provider Type Product Number
- No reagents -