HPA000600

ABHD4 antibody from Sigma-Aldrich
FLJ12816
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000600
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000600, RRID:AB_1078081
Product name
Anti-ABHD4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000600
Antibody type
Polyclonal
Antigen
Abhydrolase domain-containing protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ADDLEQQSQGWLSSWLPTWRPTSMSQLKNVEARIL
QCLQNKFLARYVSLPNQNKIWTVTVSPEQNDRTPL
VMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFG
RSSRPAFPRDPEGAEDEFVTSIETWRETMGIPSMI
LLGHSLGGF
Storage
-20C
Provider Type Product Number
- No reagents -