HPA001013

TCEANC antibody from Atlas Antibodies
MGC17403
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001013
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001013, RRID:AB_1079371
Product name
Anti-TCEANC
Provider product page
Atlas Antibodies - HPA001013
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ETDVVRAVYRVLKNCPSVALKKKAKCLLSKWKAVY
KQTHSKARNSPKLFPVRGNKEENSGPSHDPSQNET
LGICSSNSLSSQDVAKLSEMIVPENRAIQLKPKEE
HFGDGDPESTGK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -