HPA001013

TCEANC antibody from Sigma-Aldrich
MGC17403
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001013
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001013, RRID:AB_1079371
Product name
Anti-TCEANC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001013
Antibody type
Polyclonal
Antigen
TFIIS central domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ETDVVRAVYRVLKNCPSVALKKKAKCLLSKWKAVY
KQTHSKARNSPKLFPVRGNKEENSGPSHDPSQNET
LGICSSNSLSSQDVAKLSEMIVPENRAIQLKPKEE
HFGDGDPESTGK
Storage
-20C
Provider Type Product Number
- No reagents -