Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002152-M01A - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002152-M01A, RRID:AB_10629446
- Product name
- F3 monoclonal antibody (M01A), clone 4G4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant F3.
- Antigen sequence
TWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKS
KCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGN
VESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFE
QVGTK- Isotype
- IgG
- Antibody clone number
- 4G4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Enhanced tissue factor expression by blood eosinophils from patients with hypereosinophilia: a possible link with thrombosis.
Cugno M, Marzano AV, Lorini M, Carbonelli V, Tedeschi A
PloS one 2014;9(11):e111862
PloS one 2014;9(11):e111862
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- F3 monoclonal antibody (M01A), clone 4G4 Western Blot analysis of F3 expression in A-431 ( Cat # L015V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of F3 expression in transfected 293T cell line by F3 monoclonal antibody (M01A), clone 4G4.Lane 1: F3 transfected lysate(33.1 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- F3 monoclonal antibody (M01A), clone 4G4. Western Blot analysis of F3 expression in Jurkat.