HPA022277

PPM1D antibody from Atlas Antibodies
PP2C-DELTA, Wip1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA022277
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022277, RRID:AB_1858839
Product name
Anti-PPM1D
Provider product page
Atlas Antibodies - HPA022277
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KHKYIILGSDGLWNMIPPQDAISMCQDQEEKKYLM
GEHGQSCAKMLVNRALGRWRQRMLRADNTSAIVIC
ISPEVDNQGNFTNEDELYLNLT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -