HPA022277

PPM1D antibody from Sigma-Aldrich
PP2C-DELTA, Wip1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022277
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022277, RRID:AB_1858839
Product name
Anti-PPM1D antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022277
Antibody type
Polyclonal
Antigen
Protein phosphatase 1D recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KHKYIILGSDGLWNMIPPQDAISMCQDQEEKKYLM
GEHGQSCAKMLVNRALGRWRQRMLRADNTSAIVIC
ISPEVDNQGNFTNEDELYLNLT
Storage
-20C
Provider Type Product Number
- No reagents -