H00010009-M01
antibody from Abnova Corporation
Targeting: ZBTB33
kaiso, WUGSC:H_DJ525N14.1, ZNF-kaiso, ZNF348
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010009-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010009-M01, RRID:AB_464282
- Product name
- ZBTB33 monoclonal antibody (M01), clone 2B2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ZBTB33.
- Antigen sequence
QFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQY
AYLSDRSSTIPAMKDDGIGYKVDTGKEPPVGTTTS
TQNKPMTWEDIFIQQENDSIFKQNVTDGSTEFEFI
IPESY- Isotype
- IgG
- Antibody clone number
- 2B2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of ZBTB33 expression in transfected 293T cell line by ZBTB33 monoclonal antibody (M01), clone 2B2.Lane 1: ZBTB33 transfected lysate(74.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ZBTB33 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to ZBTB33 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol