HPA000755

ZBTB33 antibody from Atlas Antibodies
kaiso, WUGSC:H_DJ525N14.1, ZNF-kaiso, ZNF348
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000755
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000755, RRID:AB_1079167
Product name
Anti-ZBTB33
Provider product page
Atlas Antibodies - HPA000755
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IAELGVPLSQVKSISGTAQDGNTEPLPPDSGDKNL
VIQKSKDEAQDNGATIMPIITESFSLSAEDYEMKK
IIVTDSDDDDDDVIFCSEILPTKETLPSNNTVAQV
QSNPGPVAISD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -