Antibody data

Product number
HPA056111
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA056111, RRID:AB_2683041
Product name
Anti-PDE3B
Provider product page
Atlas Antibodies - HPA056111
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LSPVNSSNHGPVSTGSLTNRSPIEFPDTADFLNKP
SVILQRSLGNAPNTPDFYQQLRNSDSNLCNSCGHQ
MLKYVSTSESDGTDCCSGKSGEEENIFSKESFKLM
ETQQEEETEKKDSRKLFQEGDKWLTEEAQSEQQTN
IEQEVS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -