Antibody data

Product number
HPA056111
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA056111, RRID:AB_2683041
Product name
Anti-PDE3B
Provider product page
Atlas Antibodies - HPA056111
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LSPVNSSNHGPVSTGSLTNRSPIEFPDTADFLNKP
SVILQRSLGNAPNTPDFYQQLRNSDSNLCNSCGHQ
MLKYVSTSESDGTDCCSGKSGEEENIFSKESFKLM
ETQQEEETEKKDSRKLFQEGDKWLTEEAQSEQQTN
IEQEVS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -