HPA024342

PDE3B antibody from Sigma-Aldrich
HcGIP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024342
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024342, RRID:AB_1855121
Product name
Anti-PDE3B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024342
Antibody type
Polyclonal
Antigen
cGMP-inhibited 3',5'-cyclic phosphodiesterase B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PLHPRLSSAAEEKVPVIRPRRRSSCVSLGETAASY
YGSCKIFRRPSLPCISREQMILWDWDLKQWYKPHY
QNSGGGNGVDLSVLNEARNMVSDLLTDPSLPPQVI
SSLRSISSLMGAFSGSCR
Storage
-20C
Provider Type Product Number
- No reagents -