H00007498-B01P

XDH antibody from Abnova Corporation
XO, XOR
No application information provided.

Antibody data

Product number
H00007498-B01P
Provider
Abnova Corporation
Product name
XDH purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00007498-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human XDH protein.
Antigen sequence
MTADKLVFFVNGRKVVEKNADPETTLLAYLRRKLG
LSGTKLGCGEGGCGACTVMLSKYDRLQNKIVHFSA
NACLAPICSLHHVAVTTVEGIGSTKTRLHPVQERI
AKSHGSQCGFCTPGIVMSMYTLLRNQPEPTMEEIE
NAFQGNLCRCTGYRPILQGFRTFARDGGCCGGDGN
NPNCCMNQKKDHSVSLSPSLFKPEEFTPLDPTQEP
IFPPELLRLKDTPRKQLRFEGERVTWIQASTLKEL
LDLKAQHPDAKLVVGNTEIGIEMKFKNMLFPMIVC
PAWIPELNSVEHGPDGISFGAACPLSIVEKTLVDA
VAKLPAQKTEVFRGVLEQLRWFAGKQVKSVASVGG
NIITASPISDLNPVFMASGAKLTLVSRGTRRTVQM
DHTFFPGYRKTLLSPEEILLSIEIPYSREGEYFSA
FKQASRREDDIAKVTSGMRVLFKPGTTEVQELALC
YGGMANRTISALKTTQRQLSKLWKEELLQDVCAGL
AEELHLPPDAPGGMVDFRCTLTLSFFFKFYLTVLQ
KLGQENLEDKCGKLDPTFASATLLFQKDPPADVQL
FQEVPKGQSEEDMVGRPLPHLAADMQASGEAVYCD
DIPRYENELSLRLVTSTRAHAKIKSIDTSEAKKVP
GFVCFISADDVPGSNITGICNDETVFAKDKVTCVG
HIIGAVVADTPEHTQRAAQGVKITYEELPAIITIE
DAIKNNSFYGPELKIEKGDLKKGFSEADNVVSGEI
YIGGQEHFYLETHCTIAVPKGEAGEMELFVSTQNT
MKTQSFVAKMLGVPANRIVVRVKRMGGGFGGKETR
STVVSTAVALAAYKTGRPVRCMLDRDEDMLITGGR
HPFLARYKVGFMKTGTVVALEVDHFSNVGNTQDLS
QSIMERALFHMDNCYKIPNIRGTGRLCKTNLPSNT
AFRGFGGPQGMLIAECWMSEVAVTCGMPAEEVRRK
NLYKEGDLTHFNQKLEGFTLPRCWEECLASSQYHA
RKSEVDKFNKENCWKKRGLCIIPTKFGISFTVPFL
NQAGALLHVYTDGSVLLTHGGTEMGQGLHTKMVQV
ASRALKIPTSKIYISETSTNTVPNTSPTAASVSAD
LNGQAVYAACQTILKRLEPYKKKNPSGSWEDWVTA
AYMDTVSLSATGFYRTPNLGYSFETNSGNPFHYFS
YGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPA
IDIGQVEGAFVQGLGLFTLEELHYSPEGSLHTRGP
STYKIPAFGSIPIEFRVSLLRDCPNKKAIYASKAV
GEPPLFLAASIFFAIKDAIRAARAQHTGNNVKELF
RLDSPATPEKIRNACVDKFTTLCVTGVPENCKPWS
VRV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -