HPA023943

ATP6V1C1 antibody from Atlas Antibodies
ATP6C, ATP6D, VATC, Vma5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023943
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023943, RRID:AB_1845197
Product name
Anti-ATP6V1C1
Provider product page
Atlas Antibodies - HPA023943
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAI
IDAPMDIPGLNLSQQEYYPYVYYKIDC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -