Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406715 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-ATPase, H+ Transporting, Lysosomal 42kDa, V1 Subunit C1 (ATP6V1C1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ATP6V1C1 antibody: synthetic peptide directed towards the N terminal of human ATP6V1C1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
ldafvegvvkkvaqymadvledskdkvqenllang
vdlvt yitrfqwdma- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references V-ATPase interacts with ARNO and Arf6 in early endosomes and regulates the protein degradative pathway.
Hurtado-Lorenzo A, Skinner M, El Annan J, Futai M, Sun-Wada GH, Bourgoin S, Casanova J, Wildeman A, Bechoua S, Ausiello DA, Brown D, Marshansky V
Nature cell biology 2006 Feb;8(2):124-36
Nature cell biology 2006 Feb;8(2):124-36
No comments: Submit comment
No validations: Submit validation data