HPA024243

ATP6V1C1 antibody from Sigma-Aldrich
ATP6C, ATP6D, VATC, Vma5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024243
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024243, RRID:AB_1845198
Product name
Anti-ATP6V1C1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024243
Antibody type
Polyclonal
Antigen
V-type proton ATPase subunit C 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQD
SYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEE
EMKADKEEMNR
Storage
-20C
Provider Type Product Number
- No reagents -