HPA062011

ATP6V1F antibody from Atlas Antibodies
ATP6S14, VATF, Vma7
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA062011
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA062011, RRID:AB_2684656
Product name
Anti-ATP6V1F
Provider product page
Atlas Antibodies - HPA062011
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSK
EHPYDAAKDSILRRARGMFTAEDL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -