H00009296-A01

ATP6V1F antibody from Abnova Corporation
ATP6S14, VATF, Vma7
No application information provided.

Antibody data

Product number
H00009296-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009296-A01, RRID:AB_529736
Product name
ATP6V1F polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00009296-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant ATP6V1F.
Antigen sequence
VIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTT
INEIEDTFRQFLNRDDIGIILINQYIAEMVRHALD
AHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFT
AEDLR
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -