HPA023421

ATP6V1H antibody from Atlas Antibodies
CGI-11, SFD, SFDalpha, SFDbeta, VMA13
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023421
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023421, RRID:AB_1845202
Product name
Anti-ATP6V1H
Provider product page
Atlas Antibodies - HPA023421
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVM
NHMHHEDQQVRYNALLAVQKLMVHNWEYLGKQLQS
E
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -