Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006853-M07 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006853-M07, RRID:AB_607130
- Product name
- SYN1 monoclonal antibody (M07), clone 4H1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SYN1.
- Antigen sequence
EIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIG
DHQDEDKQLIVELVVNKMAQALPRQRQRDASPGRG
SHGQTPSPGALPLGRQTSQ- Isotype
- IgG
- Antibody clone number
- 4H1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SYN1 monoclonal antibody (M07), clone 4H1 Western Blot analysis of SYN1 expression in MCF-7 ( Cat # L046V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SYN1 monoclonal antibody (M07), clone 4H1. Western Blot analysis of SYN1 expression in Jurkat ( Cat # L017V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SYN1 is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol