Antibody data

Product number
ABIN502169
Provider
antibodies-online
Product name
anti-Alcohol Dehydrogenase 1A (Class I), alpha Polypeptide (ADH1A) antibody
Provider product page
antibodies-online - ABIN502169
Antibody type
Polyclonal
Antigen
The immunogen for anti-ADH1A antibody: synthetic peptide directed towards the N terminal of human ADH1A
Reactivity
Human, Canine
Host
Rabbit
Antigen sequence
ESNYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFL
GISTF SQYTVVDENA
Vial size
50 µg
Provider Type Product Number
- No reagents -