Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002730-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002730-M01, RRID:AB_606286
- Product name
- GCLM monoclonal antibody (M01), clone 2B8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant GCLM.
- Antigen sequence
MGTDSRAAKALLARARTLHLQTGNLLNWGRLRKKC
PSTHSEELHDCIQKTLNEWSSQINPDLVREFPDVL
ECTVSHAVEKINPDEREEMKVSAKLFIVESNSSSS
TRSAVDMACSVLGVAQLDSVIIASPPIEDGVNLSL
EHLQPYWEELENLVQSKKIVAIGTSDLDKTQLEQL
YQWAQVKPNSNQVNLASCCVMPPDLTAFAKQFDIQ
LLTHNDPKELLSGASFQEALQESIPDIQAHEWVPL
WLLRYSVIVKSRGIIKSKGYILQAKRRGS- Isotype
- IgG
- Antibody clone number
- 2B8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Protection against 2-chloroethyl ethyl sulfide (CEES)-induced cytotoxicity in human keratinocytes by an inducer of the glutathione detoxification pathway.
Molecular and functional characterizations of gastrula organizer cells derived from human embryonic stem cells.
Diversity in antioxidant response enzymes in progressive stages of human nonalcoholic fatty liver disease.
Induction of antioxidant enzymes by curcumin and its analogues in human islets: implications in transplantation.
Abel EL, Bubel JD, Simper MS, Powell L, McClellan SA, Andreeff M, MacLeod MC, DiGiovanni J
Toxicology and applied pharmacology 2011 Sep 1;255(2):176-83
Toxicology and applied pharmacology 2011 Sep 1;255(2):176-83
Molecular and functional characterizations of gastrula organizer cells derived from human embryonic stem cells.
Sharon N, Mor I, Golan-lev T, Fainsod A, Benvenisty N
Stem cells (Dayton, Ohio) 2011 Apr;29(4):600-8
Stem cells (Dayton, Ohio) 2011 Apr;29(4):600-8
Diversity in antioxidant response enzymes in progressive stages of human nonalcoholic fatty liver disease.
Hardwick RN, Fisher CD, Canet MJ, Lake AD, Cherrington NJ
Drug metabolism and disposition: the biological fate of chemicals 2010 Dec;38(12):2293-301
Drug metabolism and disposition: the biological fate of chemicals 2010 Dec;38(12):2293-301
Induction of antioxidant enzymes by curcumin and its analogues in human islets: implications in transplantation.
Balamurugan AN, Akhov L, Selvaraj G, Pugazhenthi S
Pancreas 2009 May;38(4):454-60
Pancreas 2009 May;38(4):454-60
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- GCLM monoclonal antibody (M01), clone 2B8 Western Blot analysis of GCLM expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged GCLM is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol