Antibody data

Product number
ABIN406408
Provider
antibodies-online
Product name
anti-Glutamate-Cysteine Ligase, Modifier Subunit (GCLM) (Middle Region) antibody
Provider product page
antibodies-online - ABIN406408
Antibody type
Polyclonal
Antigen
The immunogen for anti-GCLM antibody: synthetic peptide directed towards the middle region of human GCLM
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHND
PKELL SEASFQEALQ
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -