Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406408 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Glutamate-Cysteine Ligase, Modifier Subunit (GCLM) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GCLM antibody: synthetic peptide directed towards the middle region of human GCLM
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHND
PKELL SEASFQEALQ- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Mechanism and significance of changes in glutamate-cysteine ligase expression during hepatic fibrogenesis.
Influence of glutathione-related genes on symptoms and immunologic markers among vulcanization workers in the southern Sweden rubber industries.
Ramani K, Tomasi ML, Yang H, Ko K, Lu SC
The Journal of biological chemistry 2012 Oct 19;287(43):36341-55
The Journal of biological chemistry 2012 Oct 19;287(43):36341-55
Influence of glutathione-related genes on symptoms and immunologic markers among vulcanization workers in the southern Sweden rubber industries.
Jönsson LS, Jönsson BA, Axmon A, Littorin M, Broberg K
International archives of occupational and environmental health 2008 Jul;81(7):913-9
International archives of occupational and environmental health 2008 Jul;81(7):913-9
No comments: Submit comment
No validations: Submit validation data