Antibody data
- Antibody Data
- Antigen structure
- References [6]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002729-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002729-M01, RRID:AB_464138
- Product name
- GCLC monoclonal antibody (M01), clone 3H1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GCLC.
- Antigen sequence
EGVFPGLIPILNSYLENMEVDVDTRCSILNYLKLI
KKRASGELMTVARWMREFIANHPDYKQDSVITDEM
NYSLILKCNQIANELCECPELLGSAFRKVKYSGSK
TDSSN- Isotype
- IgG
- Antibody clone number
- 3H1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Prominent steatosis with hypermetabolism of the cell line permissive for years of infection with hepatitis C virus.
Glycogen synthase kinase 3 regulates cell death and survival signaling in tumor cells under redox stress.
The LEGSKO mouse: a mouse model of age-related nuclear cataract based on genetic suppression of lens glutathione synthesis.
Differential activation of the inflammasome in THP-1 cells exposed to chrysotile asbestos and Libby "six-mix" amphiboles and subsequent activation of BEAS-2B cells.
Protection against 2-chloroethyl ethyl sulfide (CEES)-induced cytotoxicity in human keratinocytes by an inducer of the glutathione detoxification pathway.
Diversity in antioxidant response enzymes in progressive stages of human nonalcoholic fatty liver disease.
Sugiyama K, Ebinuma H, Nakamoto N, Sakasegawa N, Murakami Y, Chu PS, Usui S, Ishibashi Y, Wakayama Y, Taniki N, Murata H, Saito Y, Fukasawa M, Saito K, Yamagishi Y, Wakita T, Takaku H, Hibi T, Saito H, Kanai T
PloS one 2014;9(4):e94460
PloS one 2014;9(4):e94460
Glycogen synthase kinase 3 regulates cell death and survival signaling in tumor cells under redox stress.
Venè R, Cardinali B, Arena G, Ferrari N, Benelli R, Minghelli S, Poggi A, Noonan DM, Albini A, Tosetti F
Neoplasia (New York, N.Y.) 2014 Sep;16(9):710-22
Neoplasia (New York, N.Y.) 2014 Sep;16(9):710-22
The LEGSKO mouse: a mouse model of age-related nuclear cataract based on genetic suppression of lens glutathione synthesis.
Fan X, Liu X, Hao S, Wang B, Robinson ML, Monnier VM
PloS one 2012;7(11):e50832
PloS one 2012;7(11):e50832
Differential activation of the inflammasome in THP-1 cells exposed to chrysotile asbestos and Libby "six-mix" amphiboles and subsequent activation of BEAS-2B cells.
Li M, Gunter ME, Fukagawa NK
Cytokine 2012 Dec;60(3):718-30
Cytokine 2012 Dec;60(3):718-30
Protection against 2-chloroethyl ethyl sulfide (CEES)-induced cytotoxicity in human keratinocytes by an inducer of the glutathione detoxification pathway.
Abel EL, Bubel JD, Simper MS, Powell L, McClellan SA, Andreeff M, MacLeod MC, DiGiovanni J
Toxicology and applied pharmacology 2011 Sep 1;255(2):176-83
Toxicology and applied pharmacology 2011 Sep 1;255(2):176-83
Diversity in antioxidant response enzymes in progressive stages of human nonalcoholic fatty liver disease.
Hardwick RN, Fisher CD, Canet MJ, Lake AD, Cherrington NJ
Drug metabolism and disposition: the biological fate of chemicals 2010 Dec;38(12):2293-301
Drug metabolism and disposition: the biological fate of chemicals 2010 Dec;38(12):2293-301
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- GCLC monoclonal antibody (M01), clone 3H1 Western Blot analysis of GCLC expression in A-431 ( Cat # L015V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of GCLC expression in transfected 293T cell line by GCLC monoclonal antibody (M01), clone 3H1.Lane 1: GCLC transfected lysate(72.8 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- GCLC monoclonal antibody (M01), clone 3H1. Western Blot analysis of GCLC expression in NIH/3T3.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged GCLC is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to GCLC on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol