HPA020136

SERPINB5 antibody from Atlas Antibodies
maspin, PI5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020136
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020136, RRID:AB_1856728
Product name
Anti-SERPINB5
Provider product page
Atlas Antibodies - HPA020136
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KSLNLSTEFISSTKRPYAKELETVDFKDKLEETKG
QINNSIKDLTDGHFENILADNSVNDQTKILVVNAA
YFVGKWMKKFPESETKECPFRVNKT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -