HPA019132

SERPINB5 antibody from Sigma-Aldrich
maspin, PI5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019132
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019132, RRID:AB_1856727
Product name
Anti-SERPINB5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019132
Antibody type
Polyclonal
Antigen
Serpin B5 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TFCMGNIDSINCKIIELPFQNKHLSMFILLPKDVE
DESTGLEKIEKQLNSESLSQWTNPSTMANAKVKLS
IPKFKVEKMIDPK
Storage
-20C
Provider Type Product Number
- No reagents -