HPA019025

SERPINB5 antibody from Atlas Antibodies
maspin, PI5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019025
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019025, RRID:AB_1856726
Product name
Anti-SERPINB5
Provider product page
Atlas Antibodies - HPA019025
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MDALQLANSAFAVDLFKQLCEKEPLGNVLFSPICL
STSLSLAQVGAKGDTANEIGQVLHFENVKDVPFGF
QTVTSDVNKLSSFYSLKLIKRLYVD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -