AV34413

PRICKLE3 antibody from Sigma-Aldrich
LMO6
No application information provided.

Antibody data

Product number
AV34413
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV34413, RRID:AB_1852961
Product name
Anti-PRICKLE3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV34413
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human PRICKLE3 with an internal ID of P23696
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
APHRHSMPELGLRSVPEPPPESPGQPNLRPDDSAF
GRQSTPRVSFRDPLV
Storage
-20C
Provider Type Product Number
- No reagents -