Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1107466 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-General Transcription Factor IIE, Polypeptide 2, beta 34kDa (GTF2E2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GTF2E2 antibody: synthetic peptide directed towards the N terminal of human GTF2E2
- Description
- Purified on peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
VEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGV
LAKIVNYMKTRHQRG- Epitope
- N-Term
- Vial size
- 50 μg
- Storage
- Store the lyophised antibody at -20°C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references The carboxy terminus of the small subunit of TFIIE regulates the transition from transcription initiation to elongation by RNA polymerase II.
Watanabe T, Hayashi K, Tanaka A, Furumoto T, Hanaoka F, Ohkuma Y
Molecular and cellular biology 2003 Apr;23(8):2914-26
Molecular and cellular biology 2003 Apr;23(8):2914-26
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Daudi; WB Suggested Anti-GTF2E2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Daudi cell lysate. GTF2E2 is supported by BioGPS gene expression data to be expressed in Daudi.; GTF2E2 antibody - N-terminal region (AP42026PU-N) in Human Daudi cells using Western Blot
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Heart; . Rabbit Anti-GTF2E2 Antibody. . ARP31434 . Paraffin Embedded Tissue: Human cardiac cell . Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X