Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182364 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-General Transcription Factor IIE, Polypeptide 2, beta 34kDa (GTF2E2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GTF2E2 antibody: synthetic peptide directed towards the N terminal of human GTF2E2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
VEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGV
LAKIV NYMKTRHQRG- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The carboxy terminus of the small subunit of TFIIE regulates the transition from transcription initiation to elongation by RNA polymerase II.
Watanabe T, Hayashi K, Tanaka A, Furumoto T, Hanaoka F, Ohkuma Y
Molecular and cellular biology 2003 Apr;23(8):2914-26
Molecular and cellular biology 2003 Apr;23(8):2914-26
No comments: Submit comment
No validations: Submit validation data