HPA003482

SNRPB antibody from Atlas Antibodies
COD, Sm-B/B', SmB/SmB', snRNP-B, SNRPB1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003482
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003482, RRID:AB_1857337
Product name
Anti-SNRPB
Provider product page
Atlas Antibodies - HPA003482
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TFKAFDKHMNLILCDCDEFRKIKPKNAKQPEREEK
RVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAG
AAGGPGVGRAAGRGVPAGVPIPQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -