Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001454-M07 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001454-M07, RRID:AB_1111754
- Product name
- CSNK1E monoclonal antibody (M07), clone 2E1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CSNK1E.
- Antigen sequence
ELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVA
IKLECVKTKHPQLHIESKFYKMMQGGVGIPSIKWC
GAEGDYNVMVMELLGPSLEDLFNFCSRKF- Isotype
- IgG
- Antibody clone number
- 2E1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to CSNK1E on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between TP53 and CSNK1E. HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-CSNK1E mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)