Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000658-M07 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000658-M07, RRID:AB_1137106
- Product name
- BMPR1B monoclonal antibody (M07), clone 2E2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant BMPR1B.
- Antigen sequence
TPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMIE
EDDSGLPVVTSGCLGLEGSDFQCRDTPIPHQRRSI
ECCTERNECNKDLHPTLPPLKNRDFVDGPIHHRA- Isotype
- IgG
- Antibody clone number
- 2E2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- BMPR1B monoclonal antibody (M07), clone 2E2. Western Blot analysis of BMPR1B expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- BMPR1B monoclonal antibody (M07), clone 2E2. Western Blot analysis of BMPR1B expression in NIH/3T3(Cat # L018V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged BMPR1B is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol